PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_16251_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 430aa    MW: 46854 Da    PI: 6.0266
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_16251_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-1657102147
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           +g+W++eEd  l ++v ++G ++W +Iar ++ gR++k+c++rw + 
  cra_locus_16251_iso_2_len_1477_ver_3  57 KGPWSPEEDVMLSRLVSKFGARNWGLIARGIP-GRSGKSCRLRWCNQ 102
                                           79******************************.***********985 PP

2Myb_DNA-binding50.83.7e-16110153247
                                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           +++++eEd+++  a+  +G++ W++Ia+ +  gRt++ +k++w++ 
  cra_locus_16251_iso_2_len_1477_ver_3 110 KPFSEEEDQIIMAAHSVHGNR-WASIAKLLS-GRTDNAIKNHWNST 153
                                           689******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.86252103IPR017930Myb domain
SuperFamilySSF466894.31E-3054150IPR009057Homeodomain-like
SMARTSM007175.6E-1556105IPR001005SANT/Myb domain
PfamPF002494.3E-1657102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2458110IPR009057Homeodomain-like
CDDcd001673.72E-1459101No hitNo description
PROSITE profilePS5129425.78104158IPR017930Myb domain
SMARTSM007175.2E-15108156IPR001005SANT/Myb domain
PfamPF002495.4E-14110153IPR001005SANT/Myb domain
CDDcd001671.73E-11111154No hitNo description
Gene3DG3DSA:1.10.10.602.3E-23111157IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MAEVAVENGA KAIDAVVDDG EQVVVDAAVD GGSGAEMLVE GYGNDGGAEG SGKGRVKGPW  60
SPEEDVMLSR LVSKFGARNW GLIARGIPGR SGKSCRLRWC NQLDPGVKHK PFSEEEDQII  120
MAAHSVHGNR WASIAKLLSG RTDNAIKNHW NSTLKRRYAE LNKVGVNSGK IFKDCSIDRA  180
KSSDEETLLP VDINSFKPPR EEDMISMEKK PSPSEIKTHT DRNCDYPEDR LVVSEGQRFC  240
TDQKNNLPVF RPVAKIGAFN VYNPCSAGSC FPRTKPMQGP LIQAPPKPDF GISKLLEGVG  300
DEPVIPLCCG HGCCSSPSGA SSKTSLLGPE FVEYEELPPF PGHELADIAS DLNNMAWIRS  360
GLENPVRVPE SATSRRLFQV SPMQMNVHQH SIHNFLIEDG GQQLTRMETN VVPTQLPLPS  420
FLLRAEVGLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-40561576107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615291.11e-131PREDICTED: transcription factor MYB122-like
RefseqXP_016434457.11e-131PREDICTED: transcription factor MYB122-like
TrEMBLA0A068V2F91e-144A0A068V2F9_COFCA; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454